PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g09510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family YABBY
Protein Properties Length: 126aa    MW: 13792.1 Da    PI: 8.0433
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g09510.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY79.11.4e-2451108461
           YABBY   4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaes 61 
                     + ++eq+Cy+ CnfCn +lavsvP +slf +vtvrCGhCt+l svn+a a q l+ ++
  Vang11g09510.1  51 DVAPEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAAFQSLSWQD 108
                     5689********************************************9999888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046909.8E-2653107IPR006780YABBY protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
LPSSLLLQER RTSYSITFIH LLLPSFSLSS SSFTLLLSRN SRSAMTTCGI DVAPEQLCYI  60
PCNFCNIVLA VSVPCSSLFD IVTVRCGHCT NLWSVNMAAA FQSLSWQDVQ LPRRGSAYLL  120
LIISL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-114AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007155017.19e-44hypothetical protein PHAVU_003G166100g
SwissprotQ8GW466e-32YAB5_ARATH; Axial regulator YABBY 5
TrEMBLA0A0L9TR254e-44A0A0L9TR25_PHAAN; Uncharacterized protein
STRINGGLYMA17G12200.12e-41(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112434112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.28e-33YABBY family protein